PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC12G02170.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 246aa    MW: 27119.7 Da    PI: 7.0136
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC12G02170.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.51.9e-1078122650
                      HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                      ++ +   NReA r++Rq+Kka +++Lee+vk L a N++L k+l+
  OPUNC12G02170.3  78 KAHKPLGNREAVRKYRQKKKAHTAHLEEEVKRLRAINQQLLKRLQ 122
                      6667778**********************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.5E-871140IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.2E-1373141No hitNo description
CDDcd146866.56E-1278131No hitNo description
SuperFamilySSF579593.25E-779123No hitNo description
PfamPF077163.7E-1182130IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005829Cellular Componentcytosol
GO:0000166Molecular Functionnucleotide binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MDDGEIELSS QMMFPNAETP TSLDDFLPSI RTTCTHTHTC NPPGPSATAH THTCYHTHTQ  60
VFSTDDDSCG GDKPKRNKAH KPLGNREAVR KYRQKKKAHT AHLEEEVKRL RAINQQLLKR  120
LQGQAALEAE VVRLRLLLVD VRSRINGALG CDGMAQCFAE KPELGVRRSC APSIVNCHIS  180
QDSGQNIVVP HTLSPSDAIG SFMVSSTSKD ELILTQICNG QLEMPDEQHK PLMPDAISHS  240
HVDTLS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1235271e-175AC123527.3 Oryza sativa (japonica cultivar-group) chromosome 11 clone OSJNBa0068G15, complete sequence.
GenBankAK1031131e-175AK103113.1 Oryza sativa Japonica Group cDNA clone:J033119E15, full insert sequence.
GenBankAK1207301e-175AK120730.1 Oryza sativa Japonica Group cDNA clone:J023003B09, full insert sequence.
GenBankAP0149671e-175AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankFQ3780341e-175FQ378034.1 Oryza glaberrima chromosome 11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619735.11e-116PREDICTED: uncharacterized protein LOC107279776
SwissprotQ8GTS23e-51BZP23_ARATH; Basic leucine zipper 23
SwissprotQ8VY763e-51BZP19_ARATH; Basic leucine zipper 19
TrEMBLA0A0E0MJE80.0A0A0E0MJE8_ORYPU; Uncharacterized protein
STRINGBGIOSGA036957-PA8e-98(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.12e-25bZIP family protein